Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d029608_circ_g.5 |
ID in PlantcircBase | zma_circ_006564 |
Alias | zma_circ_0000723, GRMZM2G028914_C2 |
Organism | Zea mays |
Position | chr1: 79104922-79108446 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d029608 |
Parent gene annotation |
Mechanosensitive ion channel protein 3 chloroplastic |
Parent gene strand | - |
Alternative splicing | Zm00001d029608_circ_g.1 Zm00001d029608_circ_g.2 Zm00001d029608_circ_g.3 Zm00001d029608_circ_g.4 Zm00001d029608_circ_g.6 Zm00001d029608_circ_g.7 Zm00001d029608_circ_g.8 Zm00001d029608_circ_g.9 Zm00001d029608_circ_g.10 Zm00001d029608_circ_g.11 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d029608_T008:5 Zm00001d029608_T011:5 Zm00001d029608_T013:5 Zm00001d029608_T014:5 Zm00001d029608_T003:5 Zm00001d029608_T005:5 Zm00001d029608_T009:5 Zm00001d029608_T007:5 Zm00001d029608_T004:5 Zm00001d029608_T001:5 Zm00001d029608_T015:5 Zm00001d029608_T002:5 Zm00001d029608_T006:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.031009113 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
79108420-79108398(-) |
Potential amino acid sequence |
MDMRNPNDTRNMGFDFTMKALYTGVWIASVSLFMELLGFNTQKWITAGGFGTVLLTLAGREIFT NFLSSVMINATRPFVVNEWIDAKIDGVDVSGIVEHVGLWSPTLIRGVDREAIYIPNHKFTVSIL RNNTQRTHWRIKTYLAISHMDAGKIGTIVADMRKVLAKNPHIEQQKLHRRVFFEKIDPKNQALM LDSAGTKVSYGHAQSQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |