Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d029608_circ_g.5 |
| ID in PlantcircBase | zma_circ_006564 |
| Alias | zma_circ_0000723, GRMZM2G028914_C2 |
| Organism | Zea mays |
| Position | chr1: 79104922-79108446 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d029608 |
| Parent gene annotation |
Mechanosensitive ion channel protein 3 chloroplastic |
| Parent gene strand | - |
| Alternative splicing | Zm00001d029608_circ_g.1 Zm00001d029608_circ_g.2 Zm00001d029608_circ_g.3 Zm00001d029608_circ_g.4 Zm00001d029608_circ_g.6 Zm00001d029608_circ_g.7 Zm00001d029608_circ_g.8 Zm00001d029608_circ_g.9 Zm00001d029608_circ_g.10 Zm00001d029608_circ_g.11 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d029608_T008:5 Zm00001d029608_T011:5 Zm00001d029608_T013:5 Zm00001d029608_T014:5 Zm00001d029608_T003:5 Zm00001d029608_T005:5 Zm00001d029608_T009:5 Zm00001d029608_T007:5 Zm00001d029608_T004:5 Zm00001d029608_T001:5 Zm00001d029608_T015:5 Zm00001d029608_T002:5 Zm00001d029608_T006:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.031009113 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
79108420-79108398(-) |
| Potential amino acid sequence |
MDMRNPNDTRNMGFDFTMKALYTGVWIASVSLFMELLGFNTQKWITAGGFGTVLLTLAGREIFT NFLSSVMINATRPFVVNEWIDAKIDGVDVSGIVEHVGLWSPTLIRGVDREAIYIPNHKFTVSIL RNNTQRTHWRIKTYLAISHMDAGKIGTIVADMRKVLAKNPHIEQQKLHRRVFFEKIDPKNQALM LDSAGTKVSYGHAQSQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |