Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0449500_circ_g.5 |
ID in PlantcircBase | osa_circ_028092 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 22062051-22062525 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0449500 |
Parent gene annotation |
Component of the SCF E3 ubiquitin ligase complex, Jasmonate-regu lated defense responses, Regulation of leaf senescence (Os05t044 9500-01) |
Parent gene strand | + |
Alternative splicing | Os05g0449500_circ_g.1 Os05g0449500_circ_g.2 Os05g0449500_circ_g.3 Os05g0449500_circ_g.4 Os05g0449500_circ_g.6 Os05g0449500_circ_g.7 Os05g0449500_circ_g.8 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0449500-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.247872298 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22062161-22062089(+) 22062415-22062516(-) |
Potential amino acid sequence |
MTELTVVPADLELLAKKCKSLISLKISDCDFSDLIGFFRMAASLQEFAGGAFIEQGELTKYGNV KFPSRLCSLGLTYMGTNEMPIIFPFSALLKKLDLQYTFLTTEDHCQLIAKCPNLLVLAITENII SGGMLNC*(+) MGISFVPMYVSPKEHSLEGNLTFPYLVSSPCSMNAPPANSCNDAAIRKNPIKSEKSQSLIFNEI SDLHFFARSSRSAGTTVSSVMWKFNVSRTGLLTARSWSHSVPLSAIEHSSRNNVLSDRKN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |