Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0832700_circ_g.1 |
| ID in PlantcircBase | osa_circ_017393 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 35810702-35810970 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0832700 |
| Parent gene annotation |
Similar to Metal tolerance protein C2 (AtMTPc2). (Os02t0832700-0 1);Similar to Metal tolerance protein C2. (Os02t0832700-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0832700-02:2 Os02t0832700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.2734272 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35810761-35810967(+) 35810759-35810927(-) |
| Potential amino acid sequence |
MQDESEHKHYLIVSAVTNLLVNLLGVWFFRSYARVNIDSSSCSSCLSPWLLKHYMHLCKMSLSI SIISLFLLSQTFWLIYLVFGSFGAMLVLT*(+) MHVVLQQPRRKTGRAGRAVYVNTSIAPKEPNTK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |