Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0284600_circ_g.1 |
| ID in PlantcircBase | osa_circ_038723 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 6253199-6257298 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0284600 |
| Parent gene annotation |
Similar to enhancer of polycomb-like protein101. (Os09t0284600-0 1) |
| Parent gene strand | - |
| Alternative splicing | Os09g0284600_circ_g.2 Os09g0284600_circ_g.3 Os09g0284600_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0284600-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.1010634 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6253220-6256928(-) 6255231-6256950(-) |
| Potential amino acid sequence |
MAGCLKGHCSTYLFGMEFSKLYIVIGKTRGNDGKSLFCGVCRLVQFLRCVFFSNLPFSC*(-) MHNVFFLFQMQRRENNIQSFEKLRMVRRNLDQAKALMDALVKREETKREAMECEVNLRRIQMKY KHEAQLVDEGTALSGFQQVSSRFGSSEDDYADSDDTTTEQPYIRPPVFRPRFADHKLSVIPTLR IKRERELKRRPQQNGWVFKRALQYLSVRYGVFQAVYSYWKDKRERWQKPILRRLQVSTISSVCL F*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |