Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0297800_circ_g.3 |
| ID in PlantcircBase | osa_circ_030588 |
| Alias | Os06circ08271/Os_ciR1595 |
| Organism | Oryza sativa |
| Position | chr6: 11049939-11050702 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
| Parent gene | Os06g0297800 |
| Parent gene annotation |
Similar to protein binding / zinc ion binding. (Os06t0297800-01) ;Similar to predicted protein. (Os06t0297800-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/9/1 |
| Tissues | leaf and panicle/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0297800-01:3 Os06t0297800-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006668* osi_circ_016104 |
| PMCS | 0.35047296 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11050234-11049980(+) |
| Potential amino acid sequence |
MEDPPSVMKINVYDFDGPFDEVESLGHAEVNFLKSNLSELSDIWIPLKGKLAQACQSKLHLRII LNNSRGTEVMKDYLDKMEKEVGKKIAVRSPHTNSAFQKIFSLPPEEFLINDFTCHLKRKMLTQE VIMESKHKGMVGC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |