Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0297800_circ_g.3 |
ID in PlantcircBase | osa_circ_030588 |
Alias | Os06circ08271/Os_ciR1595 |
Organism | Oryza sativa |
Position | chr6: 11049939-11050702 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
Parent gene | Os06g0297800 |
Parent gene annotation |
Similar to protein binding / zinc ion binding. (Os06t0297800-01) ;Similar to predicted protein. (Os06t0297800-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2/9/1 |
Tissues | leaf and panicle/root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0297800-01:3 Os06t0297800-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_006668* osi_circ_016104 |
PMCS | 0.35047296 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11050234-11049980(+) |
Potential amino acid sequence |
MEDPPSVMKINVYDFDGPFDEVESLGHAEVNFLKSNLSELSDIWIPLKGKLAQACQSKLHLRII LNNSRGTEVMKDYLDKMEKEVGKKIAVRSPHTNSAFQKIFSLPPEEFLINDFTCHLKRKMLTQE VIMESKHKGMVGC*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |