Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0132200_circ_g.2 |
| ID in PlantcircBase | osa_circ_010425 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 1556711-1559401 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os12g0132200 |
| Parent gene annotation |
Similar to CBL-interacting protein kinase 32. (Os12t0132200-01); Similar to CBL-interacting protein kinase 33. (Os12t0132200-02) |
| Parent gene strand | + |
| Alternative splicing | Os12g0132200_circ_g.3 Os12g0132200_circ_g.4 Os12g0132200_circ_g.5 Os12g0132200_circ_g.6 |
| Support reads | 5 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0132200-01:9 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.134742791 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1558896-1558324(+) |
| Potential amino acid sequence |
MSAGLNLGNLFDSEQEFKRETRFTSKCPPKEIVRKIEEAAKPLGFDVQKKNYKIKREISTMKLI KHPNVVRIYEVMGSKTKIYIVLEYVTGGELFDTIVNHGRMREDEARRYFQQLINAVDYCHSRGV YHRDLKPENLLLDSYGNLKVSDFGLSALSQQIKDDGLLHTTCGTPNYVAPEVLEDQGYDGAMAD LWSCGVILFVLLAGYLPFEDSNLMTLYKKISNAEFTFPPWTSFPAKRLLTRILDPNPMTVC*(+ ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |