Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d034673_circ_g.1 |
ID in PlantcircBase | zma_circ_006972 |
Alias | Zm01circ00190 |
Organism | Zea mays |
Position | chr1: 299505066-299505295 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d034673 |
Parent gene annotation |
Bowman-Birk type trypsin inhibitor |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | AC-AC |
Number of exons covered | Zm00001d034673_T002:1 Zm00001d034673_T001:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.07972337 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
299505170-299505167(-) |
Potential amino acid sequence |
MRSQALFFLTIALLTVLARSSNRHHHHHSHVQSRDSSKQSKQEIDKQLQSNQEQTTTAARGEEA HRSRPNSPRDGRK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |