Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d034673_circ_g.1 |
| ID in PlantcircBase | zma_circ_006972 |
| Alias | Zm01circ00190 |
| Organism | Zea mays |
| Position | chr1: 299505066-299505295 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d034673 |
| Parent gene annotation |
Bowman-Birk type trypsin inhibitor |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | AC-AC |
| Number of exons covered | Zm00001d034673_T002:1 Zm00001d034673_T001:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.07972337 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
299505170-299505167(-) |
| Potential amino acid sequence |
MRSQALFFLTIALLTVLARSSNRHHHHHSHVQSRDSSKQSKQEIDKQLQSNQEQTTTAARGEEA HRSRPNSPRDGRK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020 |