Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0136800_circ_g.1 |
| ID in PlantcircBase | osa_circ_029584 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 1952082-1952198 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0136800 |
| Parent gene annotation |
Peptidase S14, ClpP family protein. (Os06t0136800-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0136800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.269943946 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1952095-1952195(+) 1952097-1952143(-) |
| Potential amino acid sequence |
MALYDTMLSLKSPIGTHCLGFAFNLAGFILAAGEKLTPCMALYDTMLSLKSPIGTHCLGFAFNL AGFILAAGEKLTPCMALYDTMLSLKSPIGTHCLGFAFNLAGFILAAGEKLTPCMALYDTMLSLK SPIGTHCLGFAFNLAGFILAAGEK(+) MHGVSFSPAARINPAKLNAKPRQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |