Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0445000_circ_g.3 |
| ID in PlantcircBase | osa_circ_023978 |
| Alias | Os_ciR9360 |
| Organism | Oryza sativa |
| Position | chr4: 22193664-22193931 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os04g0445000 |
| Parent gene annotation |
Similar to Potassium channel SKOR (Stelar K(+) outward rectifyin g channel). (Os04t0445000-01) |
| Parent gene strand | - |
| Alternative splicing | Os04g0445000_circ_g.2 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0445000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.256630286 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22193933-22193666(-) 22193672-22193869(-) |
| Potential amino acid sequence |
MSQTLYLDMVSRVGLFRGCSDDFLSQIVLKLHEEFFLPGEVILEQGTVVDQIYIVAHGCLMSQT LYLDMVSRVGLFRGCSDDFLSQIVLKLHEEFFLPGEVILEQGTVVDQIYIVAHGCLMSQTLYLD MVSRVGLFRGCSDDFLSQIVLKLHEEFFLPGEVILEQGTVVDQIYIVAHGCLMSQTLYLDMVSR VGLFRGCSDDFLSQIVLKLHEEFFLPGEVILEQGTVVDQIYIVAHGCL(-) MPDVTDTVPGYGFESWAVQRLLG*(-) |
| Sponge-miRNAs | osa-miR2101-3p |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |