Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0291400_circ_g.1 |
ID in PlantcircBase | osa_circ_014330 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 11058364-11059791 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0291400 |
Parent gene annotation |
Similar to Calcineurin B-like protein 8. (Os02t0291400-00) |
Parent gene strand | - |
Alternative splicing | Os02g0291000_circ_ag.1 Os02g0291000_circ_g.1 Os02g0291000_circ_g.2 Os02g0291000_circ_g.3 Os02g0291000_circ_ag.4 Os02g0291000_circ_ag.5 Os02g0291400_circ_g.2 Os02g0291400_circ_g.3 Os02g0291400_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0291400-00:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.317317821 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11059717-11058365(+) 11058700-11059781(-) |
Potential amino acid sequence |
MRPSLNMEWLIFLNSSKRASTSLTEI*(+) MVLALLNESDLFLSEEAVEQIVDQTFKQADLNDDGKIDPDEWKTFASKNPALLKNMTLPYLNFS E*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |