Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0405100_circ_g.1 |
ID in PlantcircBase | osa_circ_011273 |
Alias | Os12circ05177/Os_ciR7301 |
Organism | Oryza sativa |
Position | chr12: 12196956-12199362 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, find_circ |
Parent gene | Os12g0405100 |
Parent gene annotation |
Similar to Floral homeotic protein HUA1. (Os12t0405100-01) |
Parent gene strand | + |
Alternative splicing | Os12g0405100_circ_g.2 Os12g0405100_circ_g.3 |
Support reads | 3/2/8 |
Tissues | leaf and panicle/root/shoot, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0405100-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_003413* osi_circ_010453 |
PMCS | 0.441934661 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12199359-12197013(+) 12196962-12196970(+) |
Potential amino acid sequence |
MLSNVANDFRRRRVYGVHSIP*(+) MWQMTLGGGESMESTPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNRKLAVAAARMNGEYPY RVGQPECQYYLKTGTCKFGATCKFHHPREKAALANRVQLNVLGYPMRPNEKECAYYLRTGQCKF ASTCKFHHPQPSNTMVAVRNSMYSPGQSATSPGQHTYPGAVTNWTLSRSASFIASPRWPGHSGY AQVIVPQGLVQVPGWNPYAKQCGK*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |