Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0405100_circ_g.1 |
| ID in PlantcircBase | osa_circ_011273 |
| Alias | Os12circ05177/Os_ciR7301 |
| Organism | Oryza sativa |
| Position | chr12: 12196956-12199362 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, find_circ |
| Parent gene | Os12g0405100 |
| Parent gene annotation |
Similar to Floral homeotic protein HUA1. (Os12t0405100-01) |
| Parent gene strand | + |
| Alternative splicing | Os12g0405100_circ_g.2 Os12g0405100_circ_g.3 |
| Support reads | 3/2/8 |
| Tissues | leaf and panicle/root/shoot, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0405100-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_003413* osi_circ_010453 |
| PMCS | 0.441934661 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12199359-12197013(+) 12196962-12196970(+) |
| Potential amino acid sequence |
MLSNVANDFRRRRVYGVHSIP*(+) MWQMTLGGGESMESTPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNRKLAVAAARMNGEYPY RVGQPECQYYLKTGTCKFGATCKFHHPREKAALANRVQLNVLGYPMRPNEKECAYYLRTGQCKF ASTCKFHHPQPSNTMVAVRNSMYSPGQSATSPGQHTYPGAVTNWTLSRSASFIASPRWPGHSGY AQVIVPQGLVQVPGWNPYAKQCGK*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |