Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc11g011420.1_circ_g.1 |
ID in PlantcircBase | sly_circ_003283 |
Alias | SL3.0ch11:4487178|4489486 |
Organism | Solanum lycopersicum |
Position | chr11: 4486974-4489282 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI; find_circ |
Parent gene | Solyc11g011420.1 |
Parent gene annotation |
Peptidyl-prolyl cis-trans isomerase PASTICCINO1 |
Parent gene strand | + |
Alternative splicing | Solyc11g011420.1_circ_g.2 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Solyc11g011420.1.1:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.134761138 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4487787-4486981(+) 4489275-4486981(+) |
Potential amino acid sequence |
MPRGEKAVIYVKSQYYTESTLMPVVEGVDEVHFEVELVHFIQVRDVLGDGRLIKRRIRDGRGDH *(+) MEEVITDDLGVLKKVIEEGQSWETPREPYEVKAWISAKSADGKVILSWTKDEPYFFTFGKPEVP KGLELAIATMPRGEKAVIYVKSQYYTESTLMPVVEGVDEVHFEVELVHFIQVRDVLGDGRLIKR RIRDGRGDH*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to low-temperature stress (acting as miRNA sponges) |
Other Information | |
---|---|
References | Yang et al., 2020 |