Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0679800_circ_g.4 |
ID in PlantcircBase | osa_circ_025959 |
Alias | Os_ciR1817 |
Organism | Oryza sativa |
Position | chr4: 34715338-34716007 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os04g0679800 |
Parent gene annotation |
Similar to RNA-binding protein-like protein. (Os04t0679800-01);S imilar to Zinc finger, RING-type. (Os04t0679800-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 7/1 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0679800-01:3 Os04t0679800-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015011 |
PMCS | 0.397982264 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34715938-34715943(+) |
Potential amino acid sequence |
MEMNNKVVLPNCSHAMCMKCYRQWASDFSRDYDGACLQMRMSYSPAAQFFLFLVQWTDCSLAGA LGLLRILIYKVYVDGTTTLSTHERKASIREFYAVIFPSLMQLHKGISDVDDRRQKQSVLRDTEE EMRMRARGMFLRLMSRERKSAGFAWR*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |