Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0679800_circ_g.4 |
| ID in PlantcircBase | osa_circ_025959 |
| Alias | Os_ciR1817 |
| Organism | Oryza sativa |
| Position | chr4: 34715338-34716007 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os04g0679800 |
| Parent gene annotation |
Similar to RNA-binding protein-like protein. (Os04t0679800-01);S imilar to Zinc finger, RING-type. (Os04t0679800-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 7/1 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0679800-01:3 Os04t0679800-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_015011 |
| PMCS | 0.397982264 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34715938-34715943(+) |
| Potential amino acid sequence |
MEMNNKVVLPNCSHAMCMKCYRQWASDFSRDYDGACLQMRMSYSPAAQFFLFLVQWTDCSLAGA LGLLRILIYKVYVDGTTTLSTHERKASIREFYAVIFPSLMQLHKGISDVDDRRQKQSVLRDTEE EMRMRARGMFLRLMSRERKSAGFAWR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |