Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0490000_circ_g.2 |
ID in PlantcircBase | osa_circ_037447 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 24225759-24226235 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0490000 |
Parent gene annotation |
Helix-loop-helix DNA-binding domain containing protein. (Os08t04 90000-01);Similar to Transcription factor BIM2. (Os08t0490000-02 ) |
Parent gene strand | + |
Alternative splicing | Os08g0490000_circ_g.1 Os08g0490000_circ_g.3 Os08g0490000_circ_g.4 |
Support reads | 5 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0490000-02:2 Os08t0490000-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_018013 |
PMCS | 0.180063644 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24225873-24225956(+) 24225930-24226228(-) |
Potential amino acid sequence |
MDAGSRSSGGAGFDDDDGHAARREVSSSLKELTVRVEGKGGSCSGSAGTDQMPNTPRSKHSATE QRRRSKINDRSPVVAPLRRARRRRRLLQAAAAAAAATAAGEEGWRWIHGRRLQIQWRRGLRRRR RPCRAPRGLLLAERAHGQGGRERWELQRQRWHGSDAEHAALEALRHRAAQAQQNQRQVTSGRSP SPRAPSPSPPPGRSSSSSSHRRRRGRVAVDSWTPAPDPVAARASTTTTAMPRAARSPPR*(+) MAVVVVEARAATGSGAGVHESTATLPLRRRWLLLLLLRPGGGDGDGARGEGERPLVTCR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |