Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0490000_circ_g.2 |
| ID in PlantcircBase | osa_circ_037447 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 24225759-24226235 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0490000 |
| Parent gene annotation |
Helix-loop-helix DNA-binding domain containing protein. (Os08t04 90000-01);Similar to Transcription factor BIM2. (Os08t0490000-02 ) |
| Parent gene strand | + |
| Alternative splicing | Os08g0490000_circ_g.1 Os08g0490000_circ_g.3 Os08g0490000_circ_g.4 |
| Support reads | 5 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0490000-02:2 Os08t0490000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_018013 |
| PMCS | 0.180063644 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24225873-24225956(+) 24225930-24226228(-) |
| Potential amino acid sequence |
MDAGSRSSGGAGFDDDDGHAARREVSSSLKELTVRVEGKGGSCSGSAGTDQMPNTPRSKHSATE QRRRSKINDRSPVVAPLRRARRRRRLLQAAAAAAAATAAGEEGWRWIHGRRLQIQWRRGLRRRR RPCRAPRGLLLAERAHGQGGRERWELQRQRWHGSDAEHAALEALRHRAAQAQQNQRQVTSGRSP SPRAPSPSPPPGRSSSSSSHRRRRGRVAVDSWTPAPDPVAARASTTTTAMPRAARSPPR*(+) MAVVVVEARAATGSGAGVHESTATLPLRRRWLLLLLLRPGGGDGDGARGEGERPLVTCR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |