Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_14G090500_circ_g.1 |
| ID in PlantcircBase | gma_circ_003848 |
| Alias | Gm14circRNA1406 |
| Organism | Glycine max |
| Position | chr14: 8258775-8259007 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | Tophat |
| Parent gene | GLYMA_14G090500 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH15475:1 KRH15473:1 KRH15474:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gra_circ_001076* |
| PMCS | 0.454304936 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8258838-8258795(+) 8258994-8259000(-) |
| Potential amino acid sequence |
MLIGPLLSEGCFSLPIPIISLEMLMMCTGTIFLPALVVSSMLIPFSIKHTLHTSYSFLSRPKTE *(+) MQSVFNRERDKHRRNYESWKENGAGAHHQHFQRDDWYWKAEASFREQWANQHTQRGSGNYSLSH HYSVLGLDRNE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a |