Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0292050_circ_g.2 |
| ID in PlantcircBase | osa_circ_009097 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 10651102-10651332 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os11g0292050 |
| Parent gene annotation |
Similar to PHD-finger family protein, expressed. (Os11t0292050-0 0) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 21 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0292050-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.223788384 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10651254-10651147(+) 10651164-10651306(-) |
| Potential amino acid sequence |
MQSMISGLANPHKAQVILQSLTAQNHLFQYLSQRRKEQCCQS*(+) MIMALRLTALLFSSLREILKEVVLSCQGL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |