Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.009G286300_circ_g.1 |
| ID in PlantcircBase | gra_circ_000988 |
| Alias | Chr09:24352878|24356725 |
| Organism | Gossypium raimondii |
| Position | chrChr09: 24352878-24356725 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.009G286300 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.009G286300.3:6 Gorai.009G286300.1:6 Gorai.009G286300.2:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000099* |
| PMCS | 0.099572696 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24353621-24352891(+) 24356720-24352891(+) |
| Potential amino acid sequence |
MSLSKEFEGGITNGAAWYPVYGGMQDWNYIYGGCFELTLEISDNKWPNAKELPTIWEYNKMSML NLVASLVKTGVHGRVFSSDSGRPLPGLITIKGINYTVKTSGTLADYHRLLVPGERYEGCTCC*( +) MKGALVANYPWDASLDKRKNYYACPDDGTFRFLASIYSKSHYNMSLSKEFEGGITNGAAWYPVY GGMQDWNYIYGGCFELTLEISDNKWPNAKELPTIWEYNKMSMLNLVASLVKTGVHGRVFSSDSG RPLPGLITIKGINYTVKTSGTLADYHRLLVPGERYEGCTCC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |