Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc05g013150.2_circ_g.3 |
| ID in PlantcircBase | sly_circ_001679 |
| Alias | NA |
| Organism | Solanum lycopersicum |
| Position | chr5: 6236672-6237317 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI; find_circ |
| Parent gene | Solyc05g013150.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | Solyc05g013150.2_circ_g.1 Solyc05g013150.2_circ_g.2 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc05g013150.2.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.770447846 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6237295-6236713(+) 6237176-6237305(-) |
| Potential amino acid sequence |
MLCLKVEFLVTSLQSQWALKRK*(+) MLRSRAFSRGGIQNLMLVPFADLANHSVKVTTEDHIHEVGGPAGLFSWDLLFSFQSPLRLKAGD QELNF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Yang et al., 2020 |