Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0716200_circ_g.7 |
| ID in PlantcircBase | osa_circ_003647 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 29806118-29806245 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0716200 |
| Parent gene annotation |
IQ calmodulin-binding region domain containing protein. (Os01t07 16200-01);Similar to Calmodulin binding protein. (Os01t0716200-0 2);IQ calmodulin-binding region domain containing protein. (Os01 t0716200-03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0716200-02:1 Os01t0716200-03:1 Os01t0716200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.2864625 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29806207-29806137(+) 29806209-29806120(-) |
| Potential amino acid sequence |
MVDETARTPCNPDPPNPWPW*(+) MGKSPAKWIKSVLLGKKSAKSNSTKAKDLADPDCTVFGLFRQPWGSLRRSGSSLCSSGRNQPSP TLPRPRIWRIRIARCSGCFVNHGEVSGEVDQVCAPREEISQVQLYQGQGFGGSGLHGVRAVSST MGKSPAKWIKSVLLGKKSAKSNSTKAKDLA(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |