Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA000751_circ_g.10 |
ID in PlantcircBase | osi_circ_002418 |
Alias | 1:35655269|35655703 |
Organism | Oryza sativa ssp. indica |
Position | chr1: 35655269-35655703 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA000751 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA000751_circ_g.2 BGIOSGA000751_circ_g.3 BGIOSGA000751_circ_g.4 BGIOSGA000751_circ_g.5 BGIOSGA000751_circ_g.6 BGIOSGA000751_circ_g.7 BGIOSGA000751_circ_g.8 BGIOSGA000751_circ_g.9 BGIOSGA000751_circ_g.11 BGIOSGA000751_circ_g.12 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA000751-TA:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
35655653-35655700(-) 35655635-35655551(+) |
Potential amino acid sequence |
MKKILHEKEEVLLKEQALLNQRDENILERLAYVTHSEKRVEEEKNILEAERKVLLEEKYKLELK MEAIVSREEALIQKESLLDKRESELLILQETIASKERE*(-) MQNFLHIVQRFPLEANFLLFGLIPVLYLRLSLAKLIIHSPFCQAGIPSESELPLLKLLPPFSAP TYIFPLTKPSVQLQEYSFLLPLFSLSE*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |