Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA000751_circ_g.10 |
| ID in PlantcircBase | osi_circ_002418 |
| Alias | 1:35655269|35655703 |
| Organism | Oryza sativa ssp. indica |
| Position | chr1: 35655269-35655703 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA000751 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | BGIOSGA000751_circ_g.2 BGIOSGA000751_circ_g.3 BGIOSGA000751_circ_g.4 BGIOSGA000751_circ_g.5 BGIOSGA000751_circ_g.6 BGIOSGA000751_circ_g.7 BGIOSGA000751_circ_g.8 BGIOSGA000751_circ_g.9 BGIOSGA000751_circ_g.11 BGIOSGA000751_circ_g.12 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | BGIOSGA000751-TA:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35655653-35655700(-) 35655635-35655551(+) |
| Potential amino acid sequence |
MKKILHEKEEVLLKEQALLNQRDENILERLAYVTHSEKRVEEEKNILEAERKVLLEEKYKLELK MEAIVSREEALIQKESLLDKRESELLILQETIASKERE*(-) MQNFLHIVQRFPLEANFLLFGLIPVLYLRLSLAKLIIHSPFCQAGIPSESELPLLKLLPPFSAP TYIFPLTKPSVQLQEYSFLLPLFSLSE*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |