Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0692700_circ_g.1 |
ID in PlantcircBase | osa_circ_003450 |
Alias | Os_ciR6036 |
Organism | Oryza sativa |
Position | chr1: 28583552-28583704 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Os01g0692700 |
Parent gene annotation |
Similar to Protein binding protein. (Os01t0692700-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0692700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.362264706 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28583580-28583554(-) |
Potential amino acid sequence |
MEKKCSICQELLELGDKIGYVNTGLREDEIVRNLRKVKHPAFDSSFRYSTEMEKKCSICQELLE LGDKIGYVNTGLREDEIVRNLRKVKHPAFDSSFRYSTEMEKKCSICQELLELGDKIGYVNTGLR EDEIVRNLRKVKHPAFDSSFRYSTEMEKKCSICQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |