Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0692700_circ_g.1 |
| ID in PlantcircBase | osa_circ_003450 |
| Alias | Os_ciR6036 |
| Organism | Oryza sativa |
| Position | chr1: 28583552-28583704 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0692700 |
| Parent gene annotation |
Similar to Protein binding protein. (Os01t0692700-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0692700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.362264706 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28583580-28583554(-) |
| Potential amino acid sequence |
MEKKCSICQELLELGDKIGYVNTGLREDEIVRNLRKVKHPAFDSSFRYSTEMEKKCSICQELLE LGDKIGYVNTGLREDEIVRNLRKVKHPAFDSSFRYSTEMEKKCSICQELLELGDKIGYVNTGLR EDEIVRNLRKVKHPAFDSSFRYSTEMEKKCSICQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |