Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G35090_circ_g.9 |
| ID in PlantcircBase | ath_circ_034754 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 16701463-16701552 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT4G35090 |
| Parent gene annotation |
catalase 2 |
| Parent gene strand | - |
| Alternative splicing | AT4G35090_circ_g.1 AT4G35090_circ_g.2 AT4G35090_circ_g.3 AT4G35090_circ_g.4 AT4G35090_circ_g.5 AT4G35090_circ_g.6 AT4G35090_circ_g.7 AT4G35090_circ_g.8 AT4G35090_circ_g.10 AT4G35090_circ_g.11 |
| Support reads | 88 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT4G35090.3:1 AT4G35090.2:1 AT4G35090.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.17962685 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16701531-16701465(-) 16701514-16701549(+) |
| Potential amino acid sequence |
MTRFVMLRSIQLRLLSVLENVRGLTTSRRGMTRFVMLRSIQLRLLSVLENVRGLTTSRRGMTRF VMLRSIQLRLLSVLENVRGLTTSRRGMTRFVMLRSIQLRLLSVLENVR(-) MTNLVIPRREVVNPLTFSRTDSRRSWILLSMTNLVIPRREVVNPLTFSRTDSRRSWILLSMTNL VIPRREVVNPLTFSRTDSRRSWILLSMTNLVIPRREVVN(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |