Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0813800_circ_g.2 |
| ID in PlantcircBase | osa_circ_004556 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 34608701-34609170 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0813800 |
| Parent gene annotation |
Similar to Beta-glucosidase 3. (Os01t0813800-01);Similar to cDNA , clone: J065127F19, full insert sequence. (Os01t0813800-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0813800-01:2 Os01t0813800-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.220409805 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34608740-34609115(-) 34609155-34609098(-) |
| Potential amino acid sequence |
MQLLLDCTEKNIKNSSPCHALPSGSPASFGR*(-) MLYHLDLPQALEDEYAGWLSPRIVEDFTAYADVCFREFGDRVSHWTILAEPNVAALGGYDTGEF APGRCSDPFGVTKCTVGNSSVEPYVAAHNMILTHAAVVRLYREKYQEFKSMSCFTIWISRKLWK MSMLDG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |