Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0582400_circ_g.3 |
ID in PlantcircBase | osa_circ_002336 |
Alias | Os_ciR5856 |
Organism | Oryza sativa |
Position | chr1: 22592016-22595574 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os01g0582400 |
Parent gene annotation |
Similar to Multidomain cyclophilin type peptidyl-prolyl cis-tran s isomerase. (Os01t0582400-01) |
Parent gene strand | - |
Alternative splicing | Os01g0582400_circ_g.1 Os01g0582400_circ_g.2 Os01g0582400_circ_g.4 Os01g0582400_circ_g.5 Os01g0582400_circ_g.6 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0582400-01:8 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.109049597 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22595532-22592064(+) 22595549-22592141(+) 22593389-22595523(-) |
Potential amino acid sequence |
MELICKWGPIYALTPLEESGSKVSRLLCHPV*(+) MGPHICSHPLRRIRFKSQPVAVPPCVILFISLLFCVTSCRVLTEKRCLELL*(+) MRSQILRKRRELGDIRSSETSKKTDKAHRKDKELPVHRSDDDNDDDNEDHQLTKSRKFSMKKKG IGSEASAERMSKGDANLQLLNPAEQEKHLQKQKRRRLQGREDETLAKLQKFKASFLSKNPATGN TEKKTDEEDYTGWHSNRLTFEPDSSKGVRAYMGPHLQMSSIRA*(-) |
Sponge-miRNAs | osa-miR2920 |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |