Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0582400_circ_g.3 |
| ID in PlantcircBase | osa_circ_002336 |
| Alias | Os_ciR5856 |
| Organism | Oryza sativa |
| Position | chr1: 22592016-22595574 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0582400 |
| Parent gene annotation |
Similar to Multidomain cyclophilin type peptidyl-prolyl cis-tran s isomerase. (Os01t0582400-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0582400_circ_g.1 Os01g0582400_circ_g.2 Os01g0582400_circ_g.4 Os01g0582400_circ_g.5 Os01g0582400_circ_g.6 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0582400-01:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.109049597 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22595532-22592064(+) 22595549-22592141(+) 22593389-22595523(-) |
| Potential amino acid sequence |
MELICKWGPIYALTPLEESGSKVSRLLCHPV*(+) MGPHICSHPLRRIRFKSQPVAVPPCVILFISLLFCVTSCRVLTEKRCLELL*(+) MRSQILRKRRELGDIRSSETSKKTDKAHRKDKELPVHRSDDDNDDDNEDHQLTKSRKFSMKKKG IGSEASAERMSKGDANLQLLNPAEQEKHLQKQKRRRLQGREDETLAKLQKFKASFLSKNPATGN TEKKTDEEDYTGWHSNRLTFEPDSSKGVRAYMGPHLQMSSIRA*(-) |
| Sponge-miRNAs | osa-miR2920 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |