Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0911200_circ_g.13 |
ID in PlantcircBase | osa_circ_005417 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 39702556-39702678 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0911200 |
Parent gene annotation |
Ribophorin II family protein. (Os01t0911200-01) |
Parent gene strand | + |
Alternative splicing | Os01g0911200_circ_g.5 Os01g0911200_circ_g.6 Os01g0911200_circ_g.7 Os01g0911200_circ_g.8 Os01g0911200_circ_g.9 Os01g0911200_circ_g.10 Os01g0911200_circ_g.11 Os01g0911200_circ_g.12 Os01g0911200_circ_g.14 |
Support reads | 1 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0911200-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.195800813 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
39702560-39702675(+) 39702630-39702571(+) |
Potential amino acid sequence |
MRLGVNLKNFPSLPAPAAFASLFHAGIGAVLLLYVLFWIKLMRLGVNLKNFPSLPAPAAFASLF HAGIGAVLLLYVLFWIKLMRLGVNLKNFPSLPAPAAFASLFHAGIGAVLLLYVLFWIKLMRLGV NLKNFPSLPAPAAFASLFHAGIGAVLLLYVLFWIK(+) MLELEQCCCSTFSSGLSLCVSG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |