Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0493600_circ_g.8 |
| ID in PlantcircBase | osa_circ_007269 |
| Alias | Os_ciR6810 |
| Organism | Oryza sativa |
| Position | chr10: 18739684-18739921 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os10g0493600 |
| Parent gene annotation |
Alpha-galactosidase precursor (EC 3.2.1.22) (Melibiase) (Alpha-D - galactoside galactohydrolase). (Os10t0493600-01);Alpha-galacto sidase (EC 3.2.1.22). (Os10t0493600-02);Similar to Alpha-galacto sidase. (Os10t0493600-03);Similar to Alpha-galactosidase (Fragme nt). (Os10t0493600-04) |
| Parent gene strand | + |
| Alternative splicing | Os10g0493600_circ_g.7 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0493600-04:1 Os10t0493600-03:2 Os10t0493600-02:2 Os10t0493600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.554110103 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18739686-18739707(+) 18739693-18739725(-) |
| Potential amino acid sequence |
MTSRADENDQWAAYAGPGGWNDPDMLEVGNGGMSEAEYRSHFSIWALAKYDISCRRK*(+) MSYFASAQILKCDRYSASDIPPFPTSSMSGSFHPPGPA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |