Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G236600_circ_g.1 |
| ID in PlantcircBase | gra_circ_000664 |
| Alias | Chr06:48422568|48422856 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 48422568-48422856 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G236600 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.006G236600_circ_g.2 orai.006G236600_circ_g.3 |
| Support reads | 6 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.006G236600.3:2 Gorai.006G236600.1:2 Gorai.006G236600.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000186* |
| PMCS | 0.536044291 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
48422835-48422570(-) |
| Potential amino acid sequence |
MKIDKKGRILSFSEKPKGAELKAMAVDTTVLGLSKEEAEKKPYIASMGVYVFKKEILLNLLRRA SDFGLMKIDKKGRILSFSEKPKGAELKAMAVDTTVLGLSKEEAEKKPYIASMGVYVFKKEILLN LLRRASDFGLMKIDKKGRILSFSEKPKGAELKAMAVDTTVLGLSKEEAEKKPYIASMGVYVFKK EILLNLLRRASDFGLMKIDKKGRILSFSEKPKGAELKAMAVDTTVLGLSKEEAEKKPYIASMGV YVFKKEILLNLL(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |