Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0424650_circ_g.2 |
| ID in PlantcircBase | osa_circ_039248 |
| Alias | Os_ciR3220 |
| Organism | Oryza sativa |
| Position | chr9: 15402834-15403150 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os09g0424650 |
| Parent gene annotation |
Hypothetical protein. (Os09t0424650-00) |
| Parent gene strand | - |
| Alternative splicing | Os09g0424650_circ_g.1 |
| Support reads | 4/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0424600-01:2 Os09t0424650-00:2 Os09t0424600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.201103417 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15402859-15402852(+) 15403055-15402940(+) |
| Potential amino acid sequence |
MLREKGKNLFLLTNSPFYFVDGGMSYLLEDEHFDGNSWRELFDVVIAQANKPTFYNSDHPFRAR SSVS*(+) MSILMGIPGGSSLTLSLRRQINRLSIIQTTHSEPGLPFLKDAKREGEKPISSHQLTFLLCGWRN ELLA*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |