logo





circRNA ID
Zm00001d044903_circ_g.2
Alias
zma_circ_006421, circb73-0242
Organism
Zea mays
Position
chr9: 6785076-6785994  JBrowse»
Reference genome
AGPv4.38
Type  
ie-circRNA
Identification method
CIRI, CIRCexplor2
Parent gene
Zm00001d044903
Parent gene annotation
Kinesin-like protein KCA2
Parent gene strand
-
Alternative splicing
NA
Splice junction sequence  
TTTAGGATGGTACCATGAAAAAGAACATCCAATCATCCACAACATTGAAACCTTGTTCTACTAC
TGAACTTGTGATGTTTCCTGGTAATGGTAAGTATGTgatgtttactaaatccatcaggttaaac
gaacaaagaaaatgacagaacacatatttgtattcctcataaactcaatttgcgtagatacttg
acaccata
Support reads
5
Tissues
leaf
Exon boundary  
No-No
Splicing signals  
GC-AA
Sanger sequencing for BSS  
NA
PCR primers for BSS  
NA
Assembled circRNA sequence  
NA
Sanger sequencing for FL  
NA
PCR primers for FL  
NA
Genomic sequence
GATGTTTACTAAATCCATCAGGTTAAACGAACAAAGAAAATGACAGAACACATATTTGTATTCC
TCATAAACTCAATTTGCGTAGATACTTGACACCATAAGAAATGAATGATATGGATCGAATCACT
TCTTTGTAAAGTCTCAACTGTAGATTTTAGTTGAGATTTTGTTGTTTCCTATAATTAACAGAGA
ATTGCCACAAGCTATCCTACAAACATTGTAGACACAGCAAAATGTGACATGAATCTTTGGCCCT
TTCCACATGCAGGAAGGCAATCCCACAAAACAACAAAATAATTGAAAATGAACTAGTTCATAAC
ACAGAGCACGACAAAAAAGCATAAAGAATACTTGAGAGCAACCTGTGGAGCACTTCCTAATCCT
GACTTCTCTGTAAGTCTGTCAAAAAGCTTCTCATTCTCTTCATGTAATTTCTGTATTTATTTTG
TAACAAAAAAAGGAAAGGTTTGAAAAAATGATATCAAACAAATGAGCAAAAGATATTTAGATCA
AACTGTAAGAAAACAAAGTTTCAACATGAAGTCAACAGAAAACTTGAATTGTGTTAACTTACAG
AAAAGACAGATCATGCATCAACAGTCATGGTGGAGCACACAAGGATGGCAAGAATAGTGGCAGC
ATAGATAGCAAAAATTCAACTTCTAATCAGACACCCATTCAAAAGGTTTTAGACTAAAACTGCA
GTGTGAGGAGATTTCTAAACTTGTAGTTGAAGATAGCAAAACAAAAGTTAAACATGGAACAGTC
AGAAATTAACAGGTCACACTTGCTCAATTTAGATATCAGGAGTATGTTTTATTTAGGATGGTAC
CATGAAAAAGAACATCCAATCATCCACAACATTGAAACCTTGTTCTACTACTGAACTTGTGATG
TTTCCTGGTAATGGTAAGTATGT
Number of exons covered
Zm00001d044903_T016:1
Zm00001d044903_T020:1
Zm00001d044903_T038:1
Zm00001d044903_T003:1
Zm00001d044903_T009:1
Zm00001d044903_T032:1
Zm00001d044903_T028:1
Zm00001d044903_T021:1
Zm00001d044903_T002:1
Zm00001d044903_T042:1
Zm00001d044903_T013:1
Zm00001d044903_T026:1
Zm00001d044903_T011:1
Zm00001d044903_T030:1
Zm00001d044903_T033:1
Zm00001d044903_T024:1
Zm00001d044903_T001:1
Zm00001d044903_T005:1
Zm00001d044903_T004:1
Zm00001d044903_T039:1
Zm00001d044903_T035:1
Zm00001d044903_T018:1
Conserved circRNAs
NA
Coding potential
Y
Potential coding position
6777251-6785898(-)
Potential amino acid sequence
MDLVNITYLPLPGNITSSVVEQGFNVVDDWMFFFMVPS*
Sponge-miRNAs
NA
circRNA-miRNA-mRNA network
References
Luo et al., 2019;Han et al., 2020

Copyright©2017-2021 Institute of Crop Sciences / Institute of Bioinformatics, Zhejiang University.
Any questions or suggestions, please contact the Fan's lab, bioinplant@zju.edu.cn
For submittion, please click here. Last modified at 2021-03-09.

Supported by   nsfc    zju