Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0545500_circ_g.1 |
| ID in PlantcircBase | osa_circ_034185 |
| Alias | Os_ciR10995 |
| Organism | Oryza sativa |
| Position | chr7: 21596756-21596952 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os07g0545500 |
| Parent gene annotation |
Similar to VMP4 protein. (Os07t0545500-01);Similar to cDNA clone :J033131F22, full insert sequence. (Os07t0545500-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0545500-02:1 Os07t0545500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.188325042 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21596938-21596938(-) |
| Potential amino acid sequence |
MENLFGYNSTDKSSDTKKDLSSKDATQLIRILDPKKAQNLAISLRALGVSPQEVCSAVKEGLMS S*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |