Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.002G124800_circ_g.1 |
| ID in PlantcircBase | gra_circ_000149 |
| Alias | Chr02:18402404|18403184 |
| Organism | Gossypium raimondii |
| Position | chrChr02: 18402404-18403184 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.002G124800 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.002G124800.3:1 Gorai.002G124800.5:2 Gorai.002G124800.4:2 Gorai.002G124800.2:2 Gorai.002G124800.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.112591315 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18402494-18402689(-) |
| Potential amino acid sequence |
MQLLVRARQSQEGSYVEKLDGKHQGVNQRLNKRSSDKKGWSFRKRSERHRVLSNSVIQVTTTTG LKESQDSVGFEFQQQDVSVASEKTSTVQYTEEKPQLMTPKEYIEEKSQLLALKEYTEEKSHSLT PIELAEEKSQLLAPIKCTEEKSQLTPEPEESKVPEPITATTNEAEDDFSLDESVVVIIQTAIRG FLV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |