Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.007G011500_circ_g.1 |
| ID in PlantcircBase | gra_circ_000688 |
| Alias | Chr07:907161|907350 |
| Organism | Gossypium raimondii |
| Position | chrChr07: 907161-907350 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.007G011500 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 8/18 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.007G011500.2:1 Gorai.007G011500.3:1 Gorai.007G011500.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000388* |
| PMCS | 1.197019474 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
907318-907294(-) 907173-907294(-) |
| Potential amino acid sequence |
MFVTVQGFNKTGIPSALWELMEPYAKIDEISGIAVLALVILVLSNLVSNVPTGILLSSNILLWD VCDSPRV*(-) MCLLVSYSLLIFFCGMFVTVQGFNKTGIPSALWELMEPYAKIDEISGIAVLALVILVLSNLVSN VPTGILLSSNILLWDVCDSPRV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |