Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0168200_circ_g.1 |
ID in PlantcircBase | osa_circ_018109 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 3682225-3682537 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0168200 |
Parent gene annotation |
Similar to F16A14.21. (Os03t0168200-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0168200-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.262089164 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3682303-3682302(+) 3682294-3682267(-) 3682244-3682480(-) |
Potential amino acid sequence |
MKTRRSRSEVERELGMLLKGGGSGVGTKSKYSGSKFNMLVEDIREGILCWRQTHGEKTPNQSMY WLEEITIYGQ*(+) MVISSSQYIDWFGVFSPWVCLQHSIPSLISSTSMLNLEPEYFDLVPTPEPPPFKSIPSSLSTSL RLLRVFIVHRWLSLLAST*(-) MGLSPTQYSLSDIFNKHVKLGTRVF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |