Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0169100_circ_g.1 |
| ID in PlantcircBase | osa_circ_026814 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 4142892-4143579 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0169100 |
| Parent gene annotation |
Similar to 60S ribosomal protein L10 (QM protein homolog). (Os05 t0169100-01);Similar to 60S ribosomal protein L10-2. (Os05t01691 00-02) |
| Parent gene strand | + |
| Alternative splicing | Os05g0169100_circ_g.2 Os05g0169100_circ_g.3 Os05g0169100_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0169100-01:2 Os05t0169100-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ath_circ_008949* |
| PMCS | 0.67117976 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4143313-4142961(+) 4142994-4142993(+) |
| Potential amino acid sequence |
MLSMPAKPSVVPSSSSLVAKRSLRVESGVSPSSAAMNTSGLRARVESCLMVSMLRTCKVLSPDQ EQAVPQVKVLPWCP*(+) MKKKGVDEFSHCVHLVSWEKENVTSEALEAARIACNKYMTKSAGKDAFHLRVRVHPFHVLRINK MLSCAGADRLQTGMRGAFGKPQGTCARVDIGQVLLSVRCKPNNAVHASEALRRAKFKFPGRQKI IESRKWGFTKFSRDEYVRLKSEGRIMPDGVNAKDLQGAIARSRTSRTPSQGTAVVSLTPRSGST MSG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |