Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0281400_circ_g.3 |
ID in PlantcircBase | osa_circ_030548 |
Alias | Os_ciR2215 |
Organism | Oryza sativa |
Position | chr6: 9844886-9850447 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ |
Parent gene | Os06g0281400 |
Parent gene annotation |
Similar to DNA topoisomerase. (Os06t0281400-01) |
Parent gene strand | - |
Alternative splicing | Os06g0281400_circ_g.1 Os06g0281400_circ_g.2 Os06g0281400_circ_g.4 |
Support reads | 6/2 |
Tissues | root/shoot, root, pistil |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0281400-01:8 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_006660* |
PMCS | 0.312056669 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9850419-9846158(+) 9849150-9850441(-) |
Potential amino acid sequence |
MPSEAYSSPYLSLHVSSKAEICNFREMMHKKRRDHPTTKFRV*(+) MACQMEASRTDMIQVDIGNSEGDMIFHSSASRLDFKGYQAVYDDTEASPSSYNSEVDAVHQDNF EALSKLEVKDLVSPVNVHLSQHFTKPPSRYSESALIKKLEELGIGRPSTYASIMKVLQDRKYVT IKSRVLHPEFRGRMVSAFLMHHFSEVADLSFTANMETEVW*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |