Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0281400_circ_g.3 |
| ID in PlantcircBase | osa_circ_030548 |
| Alias | Os_ciR2215 |
| Organism | Oryza sativa |
| Position | chr6: 9844886-9850447 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ |
| Parent gene | Os06g0281400 |
| Parent gene annotation |
Similar to DNA topoisomerase. (Os06t0281400-01) |
| Parent gene strand | - |
| Alternative splicing | Os06g0281400_circ_g.1 Os06g0281400_circ_g.2 Os06g0281400_circ_g.4 |
| Support reads | 6/2 |
| Tissues | root/shoot, root, pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0281400-01:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006660* |
| PMCS | 0.312056669 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9850419-9846158(+) 9849150-9850441(-) |
| Potential amino acid sequence |
MPSEAYSSPYLSLHVSSKAEICNFREMMHKKRRDHPTTKFRV*(+) MACQMEASRTDMIQVDIGNSEGDMIFHSSASRLDFKGYQAVYDDTEASPSSYNSEVDAVHQDNF EALSKLEVKDLVSPVNVHLSQHFTKPPSRYSESALIKKLEELGIGRPSTYASIMKVLQDRKYVT IKSRVLHPEFRGRMVSAFLMHHFSEVADLSFTANMETEVW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |