Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0483900_circ_g.1 |
| ID in PlantcircBase | osa_circ_030864 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 16477901-16479835 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os06g0483900 |
| Parent gene annotation |
Homeodomain-like containing protein. (Os06t0483900-01) |
| Parent gene strand | - |
| Alternative splicing | Os06g0483900_circ_ag.1 Os06g0483900_circ_g.2 Os06g0483900_circ_g.3 Os06g0484600_circ_g.1 |
| Support reads | 19 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0483900-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.500818144 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16477905-16479778(-) 16478983-16479774(-) |
| Potential amino acid sequence |
MLVVSVVAKVRECVGSDSED*(-) MLPAASGDHKSAFARSSVQKSVKNSLEGGQLEFEAKSVRDGACLSFPSLRRFVSALEVIQKIK* (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |