Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0483900_circ_g.1 |
ID in PlantcircBase | osa_circ_030864 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 16477901-16479835 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os06g0483900 |
Parent gene annotation |
Homeodomain-like containing protein. (Os06t0483900-01) |
Parent gene strand | - |
Alternative splicing | Os06g0483900_circ_ag.1 Os06g0483900_circ_g.2 Os06g0483900_circ_g.3 Os06g0484600_circ_g.1 |
Support reads | 19 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0483900-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.500818144 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16477905-16479778(-) 16478983-16479774(-) |
Potential amino acid sequence |
MLVVSVVAKVRECVGSDSED*(-) MLPAASGDHKSAFARSSVQKSVKNSLEGGQLEFEAKSVRDGACLSFPSLRRFVSALEVIQKIK* (-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |