Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc06g073270.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_002069 |
| Alias | 6:41535739|41536710 |
| Organism | Solanum lycopersicum |
| Position | chr6: 45145839-45146810 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc06g073270.2 |
| Parent gene annotation |
Golgi apparatus membrane protein-like protein ECHIDNA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc06g073270.2.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.232296005 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
45146322-45146629(-) 45145851-45146660(-) |
| Potential amino acid sequence |
MARMNKKDSWLFWWTLYLTAVAWFFLAIFSLIRFQADYLLVVGVCLTLSVANIVGFTRCRKACR GGLCTPTDMFFPCALQGSSISVLYSVSFIC*(-) MPQSLQGRTMHTHRYVFSMCSSRQQH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |