Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G35620_circ_g.3 |
ID in PlantcircBase | ath_circ_034838 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr4: 16902119-16902178 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT4G35620 |
Parent gene annotation |
Cyclin-B2-2 |
Parent gene strand | + |
Alternative splicing | AT4G35620_circ_g.1 AT4G35620_circ_g.2 AT4G35620_circ_g.4 AT4G35620_circ_g.5 AT4G35620_circ_g.6 AT4G35620_circ_g.7 AT4G35620_circ_g.8 AT4G35620_circ_g.9 AT4G35620_circ_g.10 AT4G35620_circ_g.11 AT4G35620_circ_g.12 AT4G35620_circ_g.13 |
Support reads | 2 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT4G35620.1:1 AT4G35620.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.140277778 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16902160-16902121(-) |
Potential amino acid sequence |
MNQASSCHSFLVFSLKLTDAMNQASSCHSFLVFSLKLTDAMNQASSCHSFLVFSLKLTDAMNQA SSCHSFLVF(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |