Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0314300_circ_g.2 |
| ID in PlantcircBase | osa_circ_001512 |
| Alias | Os_ciR5710 |
| Organism | Oryza sativa |
| Position | chr1: 11812728-11813576 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0314300 |
| Parent gene annotation |
Uncharacterized domain 2 containing protein. (Os01t0314300-01);U ncharacterized domain 2 containing protein. (Os01t0314300-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0314300_circ_g.3 Os01g0314300_circ_g.4 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0314300-02:3 Os01t0314300-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.267103956 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11813142-11812749(+) 11813101-11812780(+) 11813567-11813564(-) |
| Potential amino acid sequence |
MLFAFSHYSHWCFLLNFNIQGTTWRCQSRTHYVCTRENKLDSASIHLELLHDVRIFHRPSFR*( +) MSFADIFVYPIANACCLPSAIIATGVSSSTSTSKEPPGDVNPGHIMFAPERTNLIAPLSTWNFF MMSGSSTGHHLDSAYCQLQFLC*(+) MKKFQVDRGAIKFVLSGANIMCPGLTSPGGSLDVEVEEETPVAIMAEGKQHALAIGYTKMSAKD IKTINKGIGVDNMHYLNDGLWKILTS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |