Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0672200_circ_g.5 |
ID in PlantcircBase | osa_circ_015935 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 27334674-27335762 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
Parent gene | Os02g0672200 |
Parent gene annotation |
Similar to AGO1 homologous protein. (Os02t0672200-01);Similar to Protein argonaute 1A. (Os02t0672200-02) |
Parent gene strand | - |
Alternative splicing | Os02g0672200_circ_g.1 Os02g0672200_circ_g.2 Os02g0672200_circ_g.3 Os02g0672200_circ_g.4 Os02g0672200_circ_g.6 Os02g0672200_circ_g.7 Os02g0672200_circ_g.8 Os02g0672200_circ_g.9 Os02g0672200_circ_g.10 Os02g0672200_circ_g.11 |
Support reads | 3 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0672200-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.176107951 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27335706-27334702(+) 27335698-27334694(+) 27335750-27335442(+) 27335700-27335759(-) |
Potential amino acid sequence |
MVEISACSKFDHDLKWSLTPSHDQHQIMV*(+) MAKWWRSARAANLITTLNGLSRLHTISIR*(+) MVSHAFTRSASDNGLTEMSLFKSCATKSITGRGSMNAVDDISIFRESPICVGRMLW*(+) MFLAGRQADAPQEALQVLDIVLRELPTARYSPVARSFYSPNLGRRQQLGEGLESWRGFYQSIRP TQMGLSLNIDMSSTAFIEPLPVIDFVAQLLNRDISVRPLSDADRVKA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |