Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0265700_circ_g.8 |
| ID in PlantcircBase | osa_circ_019023 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 8781099-8782200 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0265700 |
| Parent gene annotation |
Similar to SH3 domain containing protein, expressed. (Os03t02657 00-01);Similar to SH3 domain containing protein, expressed. (Os0 3t0265700-02) |
| Parent gene strand | + |
| Alternative splicing | Os03g0265700_circ_g.7 Os03g0265700_circ_g.9 Os03g0265700_circ_g.10 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0265700-02:3 Os03t0265700-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.169620349 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8781141-8781149(+) 8781233-8782171(-) |
| Potential amino acid sequence |
MDTIAGLLASLMEVVRTTVACECVYVRAMVIKALIWMQNPHESFEELKSIIACELADPAWPSSL LNDVLLTLHARFKATPDMAVTLLEIARIFATKVPGKIDADVLQLLWKTCLVGAGPDGKHTALEA VTIVLDLPPPQPGSMSGFASVDMVSASDPKSAMALQRLVQAALLERLTHYQMDMVEWTQ*(+) MTIARTYTHSHATVVRTTSISDANKPAIVSIPPCPFDSGLAFRVAQLELIFAVP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |