Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G44446_circ_g.11 |
| ID in PlantcircBase | ath_circ_006009 |
| Alias | At_ciR1099 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 16850701-16850937 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | PcircRNA_finder, find_circ, CIRI-full |
| Parent gene | AT1G44446 |
| Parent gene annotation |
CH1 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 5/15 |
| Tissues | leaf/leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G44446.1:1 AT1G44446.4:1 AT1G44446.3:1 AT1G44446.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.384107564 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16850719-16850703(-) |
| Potential amino acid sequence |
MILHDKGVKGEFRVFAVFGDESGLVEKKSQWRPLFDVEDPRSKAPPYKGKFLDVNQAIEVARFD IQYLDWRARQDLLTIMILHDKGVKGEFRVFAVFGDESGLVEKKSQWRPLFDVEDPRSKAPPYKG KFLDVNQAIEVARFDIQYLDWRARQDLLTIMILHDKGVKGEFRVFAVFGDESGLVEKKSQWRPL FDVEDPRSKAPPYKGKFLDVNQAIEVARFDIQYLDWRARQDLLTIMILHDK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |