Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G44446_circ_g.11 |
ID in PlantcircBase | ath_circ_006009 |
Alias | At_ciR1099 |
Organism | Arabidpsis thaliana |
Position | chr1: 16850701-16850937 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | PcircRNA_finder, find_circ, CIRI-full |
Parent gene | AT1G44446 |
Parent gene annotation |
CH1 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 5/15 |
Tissues | leaf/leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G44446.1:1 AT1G44446.4:1 AT1G44446.3:1 AT1G44446.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.384107564 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16850719-16850703(-) |
Potential amino acid sequence |
MILHDKGVKGEFRVFAVFGDESGLVEKKSQWRPLFDVEDPRSKAPPYKGKFLDVNQAIEVARFD IQYLDWRARQDLLTIMILHDKGVKGEFRVFAVFGDESGLVEKKSQWRPLFDVEDPRSKAPPYKG KFLDVNQAIEVARFDIQYLDWRARQDLLTIMILHDKGVKGEFRVFAVFGDESGLVEKKSQWRPL FDVEDPRSKAPPYKGKFLDVNQAIEVARFDIQYLDWRARQDLLTIMILHDK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |