Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G06530_circ_g.2 |
ID in PlantcircBase | ath_circ_020074 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 2025763-2025849 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT3G06530 |
Parent gene annotation |
ARM repeat superfamily protein |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT3G06530.5:1 AT3G06530.4:1 AT3G06530.3:1 AT3G06530.1:1 AT3G06530.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.215521842 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2025847-2025846(+) |
Potential amino acid sequence |
MTWNLNLLVLKLGKDVNWPLFKNLAADDGMTWNLNLLVLKLGKDVNWPLFKNLAADDGMTWNLN LLVLKLGKDVNWPLFKNLAADDGM(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |