Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0176100_circ_g.3 |
| ID in PlantcircBase | osa_circ_013428 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 4173153-4173998 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0176100 |
| Parent gene annotation |
Similar to predicted protein. (Os02t0176100-01);Protein kinase-l ike domain containing protein. (Os02t0176100-02);Similar to pred icted protein. (Os02t0176100-03) |
| Parent gene strand | - |
| Alternative splicing | Os02g0176100_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0176100-02:5 Os02t0176100-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_012582 |
| PMCS | 0.154489972 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4173342-4173217(+) 4173371-4173949(-) |
| Potential amino acid sequence |
MLPVSWLSDIKKCCSVTGRSSGIVPPILLLLRFIVVIEVKFPRLPNCPSKFAALKIIESIFEPI HTTPCQPSPQGSPPFAVHLGRAGDPSATYSPFIAAKIYKASKGTKSIWQFPVEMIII*(+) MSDNQLTGSIPTSLSMLQSLTDMSLNDNHLDGKLPDAFGSLTGLVNFCCYKWTVCCTWITGSS* (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |