Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G31120_circ_g.3 |
ID in PlantcircBase | ath_circ_033787 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr4: 15133650-15133857 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT4G31120 |
Parent gene annotation |
Protein arginine N-methyltransferase 1.5 |
Parent gene strand | - |
Alternative splicing | AT4G31120_circ_g.1 AT4G31120_circ_g.2 AT4G31120_circ_g.4 |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT4G31120.2:2 AT4G31120.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.236678243 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15133852-15133652(-) |
Potential amino acid sequence |
MVVGAGRGPLVRASLQAAEETDRKLKVYAVEKNPNAVVTLHVLMVVGAGRGPLVRASLQAAEET DRKLKVYAVEKNPNAVVTLHVLMVVGAGRGPLVRASLQAAEETDRKLKVYAVEKNPNAVVTLHV LMVVGAGRGPLVRASLQAAEETDRKLKVYAVEKNPNAVVTLH(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |