Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0531800_circ_g.1 |
| ID in PlantcircBase | osa_circ_039956 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 20858458-20858812 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0531800 |
| Parent gene annotation |
Glycosyl transferase, family 8 protein. (Os09t0531800-01) |
| Parent gene strand | - |
| Alternative splicing | Os09g0531850_circ_ag.1 Os09g0531800_circ_ag.1 Os09g0531800_circ_ag.2 Os09g0531800_circ_ag.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0531800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_018689 |
| PMCS | 0.829586033 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20858792-20858806(-) 20858467-20858806(-) |
| Potential amino acid sequence |
MGQLLSKAREDVYDCKAVTQRLRAMLQSADEQVRSLKKQSTFLSQLAAKTIPNSIHCLSMRLTI DYYLLPLEKRKFPRSENLENPELYHYALFSDNVLAASVVNSTIMNAKCT*(-) MLSAPEKVRVMGQLLSKAREDVYDCKAVTQRLRAMLQSADEQVRSLKKQSTFLSQLAAKTIPNS IHCLSMRLTIDYYLLPLEKRKFPRSENLENPELYHYALFSDNVLAASVVNSTIMNAKCT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |