Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0531800_circ_g.1 |
ID in PlantcircBase | osa_circ_039956 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 20858458-20858812 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0531800 |
Parent gene annotation |
Glycosyl transferase, family 8 protein. (Os09t0531800-01) |
Parent gene strand | - |
Alternative splicing | Os09g0531850_circ_ag.1 Os09g0531800_circ_ag.1 Os09g0531800_circ_ag.2 Os09g0531800_circ_ag.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0531800-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_018689 |
PMCS | 0.829586033 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20858792-20858806(-) 20858467-20858806(-) |
Potential amino acid sequence |
MGQLLSKAREDVYDCKAVTQRLRAMLQSADEQVRSLKKQSTFLSQLAAKTIPNSIHCLSMRLTI DYYLLPLEKRKFPRSENLENPELYHYALFSDNVLAASVVNSTIMNAKCT*(-) MLSAPEKVRVMGQLLSKAREDVYDCKAVTQRLRAMLQSADEQVRSLKKQSTFLSQLAAKTIPNS IHCLSMRLTIDYYLLPLEKRKFPRSENLENPELYHYALFSDNVLAASVVNSTIMNAKCT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |