Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | orai.001G010300_circ_g.1 |
ID in PlantcircBase | gra_circ_000006 |
Alias | Chr01:991051|991337 |
Organism | Gossypium raimondii |
Position | chrChr01: 991051-991337 JBrowse» |
Reference genome | Graimondii_221 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Gorai.001G010300 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 8 |
Tissues | ovule |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Gorai.001G010300.2:2 Gorai.001G010300.3:2 Gorai.001G010300.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | ath_circ_022215 |
PMCS | 0.269192422 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
991143-991258(-) |
Potential amino acid sequence |
MIMLEGAKATTETVDALRTGAAAMKAMQKATGYTVLEEEETIRTTNRAAWELPASCS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Zhao et al., 2017b |