Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.001G010300_circ_g.1 |
| ID in PlantcircBase | gra_circ_000006 |
| Alias | Chr01:991051|991337 |
| Organism | Gossypium raimondii |
| Position | chrChr01: 991051-991337 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.001G010300 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 8 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.001G010300.2:2 Gorai.001G010300.3:2 Gorai.001G010300.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ath_circ_022215 |
| PMCS | 0.269192422 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
991143-991258(-) |
| Potential amino acid sequence |
MIMLEGAKATTETVDALRTGAAAMKAMQKATGYTVLEEEETIRTTNRAAWELPASCS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |