Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G27850_circ_g.2 |
ID in PlantcircBase | ath_circ_040828 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr5: 9873521-9873649 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT5G27850 |
Parent gene annotation |
60S ribosomal protein L18-3 |
Parent gene strand | + |
Alternative splicing | AT5G27850_circ_g.1 |
Support reads | 1 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT5G27850.2:1 AT5G27850.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.256461434 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9873587-9873646(+) |
Potential amino acid sequence |
MSKVNKAPLSLSRLVEFMTGKLYRFLVRRSNSNFNAVILKRLFMSKVNKAPLSLSRLVEFMTGK LYRFLVRRSNSNFNAVILKRLFMSKVNKAPLSLSRLVEFMTGKLYRFLVRRSNSNFNAVILKRL FMSKVNKAPLSLSRLVEFMTGK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |