Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.007G099500_circ_g.1 |
| ID in PlantcircBase | gra_circ_000711 |
| Alias | Chr07:7352025|7352363 |
| Organism | Gossypium raimondii |
| Position | chrChr07: 7352025-7352363 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.007G099500 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-No |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.007G099500.3:1 Gorai.007G099500.7:1 Gorai.007G099500.1:1 Gorai.007G099500.2:1 Gorai.007G099500.8:1 Gorai.007G099500.6:1 Gorai.007G099500.4:1 Gorai.007G099500.5:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.252981023 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7352153-7352356(-) |
| Potential amino acid sequence |
MQRYHAPSCTSAVNNSAIGGASVRDTPRADSSSLPPNFSLNSRSE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |