Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G19600_circ_g.6 |
| ID in PlantcircBase | ath_circ_031719 |
| Alias | At_ciR1364 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 10674772-10674906 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT4G19600 |
| Parent gene annotation |
Cyclin-T1-4 |
| Parent gene strand | + |
| Alternative splicing | AT4G19600_circ_g.1 AT4G19600_circ_g.2 AT4G19600_circ_g.3 AT4G19600_circ_g.4 AT4G19600_circ_g.5 AT4G19600_circ_g.7 AT4G19600_circ_g.8 AT4G19600_circ_g.9 |
| Support reads | 3 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G19600.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.240741975 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10674790-10674903(+) |
| Potential amino acid sequence |
MFLAGKVEETPRPLKDVIVVSYEIIHKKDPTTAQKIKQKTIATVCMFLAGKVEETPRPLKDVIV VSYEIIHKKDPTTAQKIKQKTIATVCMFLAGKVEETPRPLKDVIVVSYEIIHKKDPTTAQKIKQ KTIATVCMFLAGKVEETPRPLKDVIVVSYEIIHKKDPTTAQKIKQK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |