Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G19600_circ_g.6 |
ID in PlantcircBase | ath_circ_031719 |
Alias | At_ciR1364 |
Organism | Arabidpsis thaliana |
Position | chr4: 10674772-10674906 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | AT4G19600 |
Parent gene annotation |
Cyclin-T1-4 |
Parent gene strand | + |
Alternative splicing | AT4G19600_circ_g.1 AT4G19600_circ_g.2 AT4G19600_circ_g.3 AT4G19600_circ_g.4 AT4G19600_circ_g.5 AT4G19600_circ_g.7 AT4G19600_circ_g.8 AT4G19600_circ_g.9 |
Support reads | 3 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT4G19600.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.240741975 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10674790-10674903(+) |
Potential amino acid sequence |
MFLAGKVEETPRPLKDVIVVSYEIIHKKDPTTAQKIKQKTIATVCMFLAGKVEETPRPLKDVIV VSYEIIHKKDPTTAQKIKQKTIATVCMFLAGKVEETPRPLKDVIVVSYEIIHKKDPTTAQKIKQ KTIATVCMFLAGKVEETPRPLKDVIVVSYEIIHKKDPTTAQKIKQK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |